PDB entry 1g97

View 1g97 on RCSB PDB site
Description: s.pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+
Deposited on 2000-11-22, released 2001-05-22
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-22, with a file datestamp of 2001-05-22.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g97A (A:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
    ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
    rinhkhmvngvsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvds
    tigagavitnsmieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentkag
    hltyigncevgsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslvg
    agstitkdvpadaiaigrgrqinkde