PDB entry 1g96
View 1g96 on RCSB PDB site
Description: human cystatin c; dimeric form with 3d domain swapping
Class: hydrolase inhibitor
Keywords: human cystatin C dimer, 3D domain swapping, amyloid formation, inhibitor of C1 and C13 cysteine proteases, AMYLOID ANGIOPATHY AND CEREBRAL HEMORRHAGE, hydrolase inhibitor
Deposited on
2000-11-22, released
2001-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-11-16, with a file datestamp of
2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cystatin C
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1g96a_ - Heterogens: CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1g96A (A:)
sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagv
nyfldvelgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
Sequence, based on observed residues (ATOM records): (download)
>1g96A (A:)
vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelg
rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda