PDB entry 1g95

View 1g95 on RCSB PDB site
Description: crystal structure of s.pneumoniae glmu, apo form
Class: transferase
Keywords: GlmU, Acetyltransferase, uridyltransferase pyrophosphorylase, left-handed beta-sheet helix, trimer
Deposited on 2000-11-22, released 2001-05-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylglucosamine-1-phosphate uridyltransferase
    Species: Streptococcus pneumoniae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g95a1, d1g95a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g95A (A:)
    msnfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelve
    evlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhin
    hknvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerl
    fealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmr
    rrinhkhmvngvsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvd
    stigagavitnsmieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentka
    ghltyigncevgsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslv
    gagstitkdvpadaiaigrgrqinkdeyatrlphhpknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g95A (A:)
    snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
    vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
    knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
    ealknigeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrrrinhkh
    mvngvsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvdstigaga
    vitnsmieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentkaghltyig
    ncevgsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslvgagstit
    kdvpadaiaigrgrqinkdeyatrl