PDB entry 1g8z

View 1g8z on RCSB PDB site
Description: his57ala mutant of cholera toxin b-penatmer
Class: toxin
Keywords: toxin
Deposited on 2000-11-21, released 2001-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b protein
    Species: Vibrio cholerae
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • engineered (56)
    Domains in SCOP 1.73: d1g8zd_
  • Chain 'E':
    Compound: cholera toxin b protein
    Species: Vibrio cholerae
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • engineered (56)
    Domains in SCOP 1.73: d1g8ze_
  • Chain 'F':
    Compound: cholera toxin b protein
    Species: Vibrio cholerae
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • engineered (56)
    Domains in SCOP 1.73: d1g8zf_
  • Chain 'G':
    Compound: cholera toxin b protein
    Species: Vibrio cholerae
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • engineered (56)
    Domains in SCOP 1.73: d1g8zg_
  • Chain 'H':
    Compound: cholera toxin b protein
    Species: Vibrio cholerae
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • engineered (56)
    Domains in SCOP 1.73: d1g8zh_
  • Heterogens: GAL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8zD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8zE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8zF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8zG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8zH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman