PDB entry 1g8z

View 1g8z on RCSB PDB site
Description: his57ala mutant of cholera toxin b-penatmer
Class: toxin
Keywords: toxin
Deposited on 2000-11-21, released 2001-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin b protein
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (56)
  Domains in SCOPe 2.08: d1g8zd_
• Chain 'E':
  Compound: cholera toxin b protein
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (56)
  Domains in SCOPe 2.08: d1g8ze_
• Chain 'F':
  Compound: cholera toxin b protein
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (56)
  Domains in SCOPe 2.08: d1g8zf_
• Chain 'G':
  Compound: cholera toxin b protein
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (56)
  Domains in SCOPe 2.08: d1g8zg_
• Chain 'H':
  Compound: cholera toxin b protein
  Species: Vibrio cholerae [TaxId:666]
  Gene: CTXB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • engineered (56)
  Domains in SCOPe 2.08: d1g8zh_
• Heterogens: GAL, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g8zD (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g8zE (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g8zF (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g8zG (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g8zH (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqaids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman