PDB entry 1g8y

View 1g8y on RCSB PDB site
Description: crystal structure of the hexameric replicative helicase repa of plasmid rsf1010
Deposited on 2000-11-21, released 2001-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g8ya_
  • Chain 'B':
    Domains in SCOP 1.55: d1g8yb_
  • Chain 'C':
    Domains in SCOP 1.55: d1g8yc_
  • Chain 'D':
    Domains in SCOP 1.55: d1g8yd_
  • Chain 'E':
    Domains in SCOP 1.55: d1g8ye_
  • Chain 'F':
    Domains in SCOP 1.55: d1g8yf_
  • Chain 'G':
    Domains in SCOP 1.55: d1g8yg_
  • Chain 'H':
    Domains in SCOP 1.55: d1g8yh_
  • Chain 'I':
    Domains in SCOP 1.55: d1g8yi_
  • Chain 'J':
    Domains in SCOP 1.55: d1g8yj_
  • Chain 'K':
    Domains in SCOP 1.55: d1g8yk_
  • Chain 'L':
    Domains in SCOP 1.55: d1g8yl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8yA (A:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yA (A:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g8yB (B:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yB (B:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g8yC (C:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yC (C:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g8yD (D:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yD (D:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g8yE (E:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yE (E:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g8yF (F:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yF (F:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g8yG (G:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yG (G:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1g8yH (H:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yH (H:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1g8yI (I:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yI (I:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1g8yJ (J:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yJ (J:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1g8yK (K:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yK (K:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1g8yL (L:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
    kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
    nygapfadrwfrrhdggvlkpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8yL (L:)
    athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
    evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
    ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
    lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
    pa