PDB entry 1g8p

View 1g8p on RCSB PDB site
Description: crystal structure of bchi subunit of magnesium chelatase
Deposited on 2000-11-20, released 2001-08-03
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-03, with a file datestamp of 2001-08-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1g8pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8pA (A:)
    mttavarlqpsasgaktrpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkst
    avralaallpeieavegcpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvg
    aldieraiskgekafepgllaranrgylyidecnlledhivdllldvaqsgenvverdgl
    sirhparfvlvgsgnpeegdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpka
    fleewrpkdmdirnqilearerlpkveapntalydcaalcialgsdglrgeltllrsara
    laalegatavgrdhlkrvatmalshrlrrdpldeagstarvartveetlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8pA (A:)
    rpvfpfsaivgqedmklallltavdpgiggvlvfgdrgtgkstavralaallpeieaveg
    cpvsspnvemipdwatvlstnvirkptpvvdlplgvsedrvvgaldieraiskgekafep
    gllaranrgylyidecnlledhivdllldvaqsgenvverdglsirhparfvlvgsgnpe
    egdlrpqlldrfglsvevlsprdvetrvevirrrdtydadpkafleewrpkdmdirnqil
    earerlpkveapntalydcaalcialgsdglrgeltllrsaralaalegatavgrdhlkr
    vatmalshrlrvartveetlp