PDB entry 1g8l

View 1g8l on RCSB PDB site
Description: crystal structure of escherichia coli moea
Deposited on 2000-11-17, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8lA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8lB (B:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg