PDB entry 1g8l

View 1g8l on RCSB PDB site
Description: crystal structure of escherichia coli moea
Class: metal binding protein
Keywords: Molybdenum cofactor biosynthesis, METAL BINDING PROTEIN
Deposited on 2000-11-17, released 2001-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin biosynthesis moea protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8la1, d1g8la2, d1g8la3
  • Chain 'B':
    Compound: molybdopterin biosynthesis moea protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8lb1, d1g8lb2, d1g8lb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8lA (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8lA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g8lB (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8lB (B:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg