PDB entry 1g8k

View 1g8k on RCSB PDB site
Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Class: oxidoreductase
Keywords: OXIDASE, ARSENITE, MOLYBDOPTERIN, [3Fe-4S] CLUSTER, [2Fe-2S] CLUSTER, RIESKE, OXIDOREDUCTASE
Deposited on 2000-11-17, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.154
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8ka1, d1g8ka2
  • Chain 'B':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kb_
  • Chain 'C':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kc1, d1g8kc2
  • Chain 'D':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kd_
  • Chain 'E':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8ke1, d1g8ke2
  • Chain 'F':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kf_
  • Chain 'G':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kg1, d1g8kg2
  • Chain 'H':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g8kh_
  • Heterogens: HG, CA, MGD, O, 4MO, F3S, FES, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8kA (A:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lavtltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8kA (A:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kB (B:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g8kC (C:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lavtltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8kC (C:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kD (D:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g8kE (E:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lavtltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8kE (E:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kF (F:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g8kG (G:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lavtltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8kG (G:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kH (H:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi