PDB entry 1g8f

View 1g8f on RCSB PDB site
Description: ATP sulfurylase from s. cerevisiae
Class: transferase
Keywords: alpha-beta protein, beta-barrel, Rossmann-fold, kinase fold
Deposited on 2000-11-17, released 2001-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2001-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08536 (Start-510)
      • conflict (130)
      • conflict (456)
    Domains in SCOP 1.73: d1g8fa1, d1g8fa2, d1g8fa3
  • Heterogens: CD, CA, NA, MG, SO4, TRS, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8fA (A:)
    mpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfl
    nendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdv
    ykpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlr
    lefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvr
    vyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknsk
    gvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgte
    lrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstfl
    qfgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsss
    adiqlesadepishivqkvvlfledngffvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8fA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf