PDB entry 1g8e

View 1g8e on RCSB PDB site
Description: crystal structure of flhd from escherichia coli
Class: transcription
Keywords: genetic regulator, DNA binding protein
Deposited on 2000-11-17, released 2001-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flagellar transcriptional activator flhd
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g8ea_
  • Chain 'B':
    Compound: flagellar transcriptional activator flhd
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g8eb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8eA (A:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8eA (A:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g8eB (B:)
    mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
    nqlvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnqpeealrkkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8eB (B:)
    tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
    lvchfrfdshqtitqltqds