PDB entry 1g8e

View 1g8e on RCSB PDB site
Description: crystal structure of flhd from escherichia coli
Deposited on 2000-11-17, released 2001-03-07
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1g8ea_
  • Chain 'B':
    Domains in SCOP 1.57: d1g8eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g8eA (A:)
mhtsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaet
nqlvchfrfdshqtitqltqdsrvddlqqihtgimlst

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g8eB (B:)
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitqltqds