PDB entry 1g88

View 1g88 on RCSB PDB site
Description: s4afl3arg515 mutant
Class: transcription
Keywords: transcriptional factor, L3 loop mutant
Deposited on 2000-11-16, released 2000-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13485 (0-End)
      • engineered (230)
    Domains in SCOPe 2.07: d1g88a_
  • Chain 'B':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13485 (0-End)
      • engineered (230)
    Domains in SCOPe 2.07: d1g88b_
  • Chain 'C':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13485 (0-End)
      • engineered (230)
    Domains in SCOPe 2.07: d1g88c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g88A (A:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdypsqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g88A (A:)
    nghlqhhppmppqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsg
    gdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldrea
    grapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaaagigvddlrrlcilrms
    fvkgwgpdypsqsiketpcwieihlhralqlldevlhtmpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g88B (B:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdypsqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g88B (B:)
    nghlqhhppmppafqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdp
    sggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldr
    eagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaavaapaislsaaa
    gigvddlrrlcilrmsfvkgwgpdypsqsiketpcwieihlhralqlldevlhtmpiadp
    qp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g88C (C:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdypsqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g88C (C:)
    nghlqhhppmppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdr
    fclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagra
    pgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaavapaislsaaagigvdd
    lrrlcilrmsfvkgwgpdypsqsiketpcwieihlhralqlldevlhtmpiadpqp