PDB entry 1g87

View 1g87 on RCSB PDB site
Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum
Class: hydrolase
Keywords: endoglucanase, cellulase 9g, cellulose binding domain, (alpha/alpha)6-helix barrel, beta barrel, hydrolase
Deposited on 2000-11-16, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endocellulase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • conflict (573-574)
    Domains in SCOPe 2.07: d1g87a1, d1g87a2
  • Chain 'B':
    Compound: endocellulase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • conflict (573-574)
    Domains in SCOPe 2.07: d1g87b1, d1g87b2
  • Heterogens: CA, MG, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g87A (A:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g87A (A:)
    tynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkf
    nlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdgg
    kdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcisha
    knlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwg
    keqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytp
    kglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvv
    gygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneia
    cdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvynq
    tgwparvtdkisfkyfmdlseivaagidplslvtssysegkntkvsgvlpwdvsnnvyyv
    nvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnipvy
    dngvkvfgnep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g87B (B:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g87B (B:)
    gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
    fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
    gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
    aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
    gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
    pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
    vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
    acdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvyn
    qtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvy
    yvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnip
    vydngvkvfgnep