PDB entry 1g86

View 1g86 on RCSB PDB site
Description: charcot-leyden crystal protein/n-ethylmaleimide complex
Class: hydrolase
Keywords: beta barrel
Deposited on 2000-11-16, released 2002-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2002-06-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: charcot-leyden crystal protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g86a_
  • Heterogens: NEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g86A (A:)
    msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr
    rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
    vkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g86A (A:)
    sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylkr