PDB entry 1g86

View 1g86 on RCSB PDB site
Description: charcot-leyden crystal protein/n-ethylmaleimide complex
Deposited on 2000-11-16, released 2002-06-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1g86a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g86A (A:)
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr