PDB entry 1g84

View 1g84 on RCSB PDB site
Description: the solution structure of the c epsilon2 domain from ige
Deposited on 2000-11-16, released 2001-05-16
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1g84a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g84A (A:)
    srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
    tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa