PDB entry 1g81

View 1g81 on RCSB PDB site
Description: chorismate lyase with bound product, orthorhombic crystal form
Class: lyase
Keywords: new fold, ubiquinone pathway, 123654 antiparallel sheet topology, product inhibition, lyase
Deposited on 2000-11-15, released 2001-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chorismate lyase
  Species: Escherichia coli [TaxId:562]
  Gene: ubiC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26602 (0-163)
    • engineered (13)
  Domains in SCOPe 2.08: d1g81a_
• Heterogens: PHB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g81A (A:)
  shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
  peelpllpkesrywlreillcadgepwlagrtvvpvstlsgpelalqklgktplgrylft
  sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply