PDB entry 1g7y

View 1g7y on RCSB PDB site
Description: the crystal structure of the 58kd vegetative lectin from the tropical legume dolichos biflorus
Class: sugar binding protein
Keywords: jelly roll fold, lectin
Deposited on 2000-11-15, released 2000-11-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7ya_
  • Chain 'B':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7yb_
  • Chain 'C':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7yc_
  • Chain 'D':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7yd_
  • Chain 'E':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7ye_
  • Chain 'F':
    Compound: stem/leaf lectin db58
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1g7yf_
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g7yA (A:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7yA (A:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddsepl
    diasylvrnvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g7yB (B:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7yB (B:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpldiasy
    lvrnvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g7yC (C:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7yC (C:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddsepl
    diasylvrnvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7yD (D:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g7yE (E:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7yE (E:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddsldi
    asylvrnvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g7yF (F:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
    pldiasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7yF (F:)
    adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
    tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
    avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
    hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpldiasy
    lvrnvl