PDB entry 1g7v

View 1g7v on RCSB PDB site
Description: crystal structures of kdo8p synthase in its binary complexes with the mechanism-based inhibitor
Deposited on 2000-11-14, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1g7va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7vA (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk