PDB entry 1g7q

View 1g7q on RCSB PDB site
Description: crystal structure of mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and muc1 vntr peptide sapdtrpa
Deposited on 2000-11-13, released 2002-07-17
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7qA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7qB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm