PDB entry 1g7p

View 1g7p on RCSB PDB site
Description: crystal structure of MHC class I h-2kb heavy chain complexed with beta-2 microglobulin and yeast alpha-glucosidase
Class: Immune System
Keywords: MHC class I, H-2Kb, YEAST, S. cerevisiae, alpha-glucosidase
Deposited on 2000-11-13, released 2002-07-17
The last revision prior to the SCOP 1.75 freeze date was dated 2002-07-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g7pa1, d1g7pa2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g7pb_
  • Chain 'P':
    Compound: alpha-glucosidase p1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB CAA00532 (0-8)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7pA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7pB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.