PDB entry 1g7e

View 1g7e on RCSB PDB site
Description: nmr structure of n-domain of erp29 protein
Class: chaperone
Keywords: alfa-beta structure, thioredoxin fold, CHAPERONE
Deposited on 2000-11-10, released 2000-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum protein erp29
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g7ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7eA (A:)
    lhtkgalpldtvtfykvipkskfvlvkfdtqypygekqdefkrlaensassddllvaevg
    isdygdklnmelsekykldkesypvfylfrdgdfenpvpysgavkvgaiqrwlkgqgvyl
    gm