PDB entry 1g7d

View 1g7d on RCSB PDB site
Description: nmr structure of erp29 c-domain
Class: chaperone
Keywords: alpha helical protein, CHAPERONE
Deposited on 2000-11-10, released 2000-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endoplasmic reticulum protein erp29
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52555 (0-105)
  Domains in SCOPe 2.05: d1g7da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7dA (A:)
  pgclpaydalagqfieassrearqailkqgqdglsgvketdkkwasqylkimgkildqge
  dfpaselarisklienkmsegkkeelqrslniltafrkkgaekeel