PDB entry 1g7c

View 1g7c on RCSB PDB site
Description: yeast eef1a:eef1ba in complex with gdpnp
Class: translation
Keywords: protein-protein complex, TRANSLATION
Deposited on 2000-11-10, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g7ca1, d1g7ca2, d1g7ca3
  • Chain 'B':
    Compound: elongation factor 1-beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TEF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g7cb_
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g7cA (A:)
    mgkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvl
    dklkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggv
    gefeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvg
    ynpktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
    dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
    vpgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvld
    chtahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplg
    rfavrdmrqtvavgviksvdktekaakvtkaaqkaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7cA (A:)
    ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
    kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
    eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
    ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptdkp
    lrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgvpg
    dnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldcht
    ahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgrfa
    vrdmrqtvavgviksvdkte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g7cB (B:)
    kpakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqinc
    vveddkvslddlqqsieededhvqstdiaamqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g7cB (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl