PDB entry 1g7a

View 1g7a on RCSB PDB site
Description: 1.2 A structure of T3R3 human insulin at 100 K
Class: hormone/growth factor
Keywords: T3R3 Insulin Hexamer, hormone-growth factor COMPLEX
Deposited on 2000-11-09, released 2001-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1g7a.1
• Chain 'B':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1g7a.1
• Chain 'C':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1g7a.2
• Chain 'D':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1g7a.2
• Chain 'E':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1g7a.3
• Chain 'F':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1g7a.3
• Chain 'G':
  Compound: insulin a-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1g7a.4
• Chain 'H':
  Compound: insulin b-chain
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308
  Domains in SCOPe 2.08: d1g7a.4
• Heterogens: ZN, CL, ACN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1g7aD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1g7aD (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aF (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g7aG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >1g7aH (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1g7aH (H:)
  vnqhlcgshlvealylvcgergffytpk