PDB entry 1g79

View 1g79 on RCSB PDB site
Description: x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 2.0 a resolution
Deposited on 2000-11-09, released 2000-11-29
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1g79a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g79A (A:)
gglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhydekgm
vfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkyfhsrprdsqi
gawvskqssrisargileskflelkqkfqqgevplpsfwggfrvsleqiefwqggehrlh
drflyqrendawkidrlap