PDB entry 1g72

View 1g72 on RCSB PDB site
Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation
Class: oxidoreductase
Keywords: Quinoprotein, OXIDOREDUCTASE
Deposited on 2000-11-08, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase heavy subunit
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g72a_
  • Chain 'B':
    Compound: methanol dehydrogenase light subunit
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g72b_
  • Chain 'C':
    Compound: methanol dehydrogenase heavy subunit
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g72c_
  • Chain 'D':
    Compound: methanol dehydrogenase light subunit
    Species: METHYLOPHILUS METHYLOTROPHUS [TaxId:2327]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g72d_
  • Heterogens: CA, PQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g72A (A:)
    madadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegap
    lvigdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqi
    vkkqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgav
    nafdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwg
    wyaydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdf
    agvnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlkt
    gtpvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpy
    ragqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglv
    wyatldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvf
    dltdpsaglgavgafrelqnhtqmggglmvfsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g72A (A:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g72B (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g72B (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g72C (C:)
    madadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegap
    lvigdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqi
    vkkqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgav
    nafdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwg
    wyaydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdf
    agvnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlkt
    gtpvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpy
    ragqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglv
    wyatldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvf
    dltdpsaglgavgafrelqnhtqmggglmvfsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g72C (C:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g72D (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
    sgnfvfdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g72D (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian