PDB entry 1g6z

View 1g6z on RCSB PDB site
Description: solution structure of the clr4 chromo domain
Class: transferase
Keywords: transferase
Deposited on 2000-11-08, released 2001-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: clr4 protein
  Species: Schizosaccharomyces pombe [TaxId:4896]
  Gene: CLR4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60016 (2-69)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1g6za1, d1g6za2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g6zA (A:)
  isspkqeeyeverivdekldrngavklyrirwlnyssrsdtweppenlsgcsavlaewkr
  rkrrlkgsns