PDB entry 1g6y

View 1g6y on RCSB PDB site
Description: crystal structure of the globular region of the prion protein ure2 from yeast saccharomyces cerevisiae
Class: structural genomics
Keywords: GST SUPERFAMILY, structural genomics
Deposited on 2000-11-08, released 2001-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URE2 OR YNL229C OR N1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g6ya1, d1g6ya2
  • Chain 'B':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: URE2 OR YNL229C OR N1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g6yb1, d1g6yb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g6yA (A:)
    mshveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehra
    pefvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqin
    awlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvme
    ldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpe
    vykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g6yA (A:)
    qplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarvpal
    idhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffqtsghapmig
    qalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmeldtenaaaysagttp
    msqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmmrrpavi
    kalrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g6yB (B:)
    mshveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehra
    pefvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqin
    awlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvme
    ldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpe
    vykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g6yB (B:)
    eysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefv
    svnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlf
    fqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmeldte
    naaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykw
    tkhmmrrpavikalrge