PDB entry 1g6x

View 1g6x on RCSB PDB site
Description: ultra high resolution structure of bovine pancreatic trypsin inhibitor (bpti) mutant with altered binding loop sequence
Class: hydrolase inhibitor
Keywords: serine protease inhibitor, hydrolase inhibitor
Deposited on 2000-11-08, released 2001-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.107
AEROSPACI score: 1.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (10)
      • engineered (12)
      • engineered (14)
      • engineered (51)
    Domains in SCOPe 2.06: d1g6xa_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6xA (A:)
    rpdfcleppyagacrariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga