PDB entry 1g6t

View 1g6t on RCSB PDB site
Description: structure of epsp synthase liganded with shikimate-3-phosphate
Deposited on 2000-11-07, released 2001-02-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.155
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1g6ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6tA (A:)
    mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
    gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
    mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
    plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
    gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
    lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
    eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
    arisqaa