PDB entry 1g6s

View 1g6s on RCSB PDB site
Description: structure of epsp synthase liganded with shikimate-3-phosphate and glyphosate
Class: transferase
Keywords: two-domain structure; inside-out alpha-beta barrel
Deposited on 2000-11-07, released 2001-02-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.149
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epsp synthase
    Species: Escherichia coli
    Gene: aroA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g6sa_
  • Heterogens: S3P, GPJ, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6sA (A:)
    mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
    gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
    mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
    plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
    gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
    lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
    eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
    arisqaa