PDB entry 1g6r

View 1g6r on RCSB PDB site
Description: a functional hot spot for antigen recognition in a superagonist tcr/MHC complex
Class: immune system
Keywords: t cell antigen receptor, major histocompatibility complex, superagonist, immune system
Deposited on 2000-11-07, released 2000-11-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.298
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha t cell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-201)
      • conflict (121)
      • conflict (157)
    Domains in SCOPe 2.03: d1g6ra1, d1g6ra2
  • Chain 'B':
    Compound: beta t cell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01852 (0-236)
      • conflict (95)
      • conflict (97)
      • conflict (10)
      • conflict (99-102)
      • conflict (107)
    Domains in SCOPe 2.03: d1g6rb1, d1g6rb2
  • Chain 'C':
    Compound: alpha t cell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-201)
      • conflict (121)
      • conflict (157)
    Domains in SCOPe 2.03: d1g6rc1, d1g6rc2
  • Chain 'D':
    Compound: beta t cell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01852 (0-236)
      • conflict (95)
      • conflict (97)
      • conflict (10)
      • conflict (99-102)
      • conflict (107)
    Domains in SCOPe 2.03: d1g6rd1, d1g6rd2
  • Chain 'H':
    Compound: major histocompatibility complex class I molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1g6rh1, d1g6rh2
  • Chain 'I':
    Compound: major histocompatibility complex class I molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1g6ri1, d1g6ri2
  • Chain 'L':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1g6rl_
  • Chain 'M':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1g6rm_
  • Chain 'P':
    Compound: siyr peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1G6R (0-7)
  • Chain 'Q':
    Compound: siyr peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1G6R (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rB (B:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rC (C:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rD (D:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rI (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rL (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rM (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.