PDB entry 1g6r

View 1g6r on RCSB PDB site
Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
Deposited on 2000-11-07, released 2000-11-15
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.298
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rB (B:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rC (C:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rD (D:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rI (I:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rL (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6rM (M:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm