PDB entry 1g6p

View 1g6p on RCSB PDB site
Description: solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Class: structural genomics
Keywords: greek-key, beta barrel, OB-fold, STRUCTURAL GENOMICS
Deposited on 2000-11-07, released 2001-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cold shock protein tmcsp
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g6pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g6pA (A:)
mrgkvkwfdskkgygfitkdeggdvfvhwsaiemegfktlkegqvvefeiqegkkgpqaa
hvkvve