PDB entry 1g6p

View 1g6p on RCSB PDB site
Description: solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Deposited on 2000-11-07, released 2001-11-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: NMR7
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1g6pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g6pA (A:)
  mrgkvkwfdskkgygfitkdeggdvfvhwsaiemegfktlkegqvvefeiqegkkgpqaa
  hvkvve