PDB entry 1g6m

View 1g6m on RCSB PDB site
Description: nmr solution structure of cbt2
Class: toxin
Keywords: all beta-sheet protein, TOXIN
Deposited on 2000-11-07, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short neurotoxin 1
    Species: Naja kaouthia [TaxId:8649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g6ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6mA (A:)
    lechnqqssqtptttgcsggenncykkewrdnrgyrtergcgcpsvkkgiginccttdrc
    nn