PDB entry 1g6m

View 1g6m on RCSB PDB site
Description: nmr solution structure of cbt2
Deposited on 2000-11-07, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g6ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6mA (A:)
    lechnqqssqtptttgcsggenncykkewrdnrgyrtergcgcpsvkkgiginccttdrc
    nn