PDB entry 1g6g

View 1g6g on RCSB PDB site
Description: x-ray structure of the n-terminal fha domain from s. cerevisiae rad53p in complex with a phosphothreonine peptide at 1.6 a resolution
Class: cell cycle
Keywords: beta-sandwich, phosphopeptide complex, CELL CYCLE
Deposited on 2000-11-06, released 2000-12-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase rad53
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g6ga_
  • Chain 'B':
    Compound: protein kinase rad53
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RAD53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1g6gb_
  • Chain 'E':
    Compound: ser-leu-glu-val-tpo-glu-ala-aspala-thr-phe-ala-lys
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1G6G (0-End)
  • Chain 'F':
    Compound: ser-leu-glu-val-tpo-glu-ala-aspala-thr-phe-ala-lys
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1G6G (Start-12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g6gA (A:)
genivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpacdyhlgnisrlsnkh
fqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvgvgvesdilslvifin
dkfkqcl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1g6gB (B:)
genivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpacdyhlgnisrlsnkh
fqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvgvgvesdilslvifin
dkfkqcl

    Sequence, based on observed residues (ATOM records): (download) 
    >1g6gB (B:)
ivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpacdyhlgnisrlsnkhfqi
llgedgnlllndistngtwlngqkveknsnqllsqgdeitvgvgvesdilslvifindkf
kqcl

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.