PDB entry 1g69

View 1g69 on RCSB PDB site
Description: thiamin phosphate synthase
Class: transferase
Keywords: thiamin biosynthesis, tim barrel, transferase
Deposited on 2000-11-03, released 2001-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.215
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiamin phosphate synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: THIC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39594
      • cloning artifact (2-5)
      • engineered (122)
    Domains in SCOPe 2.06: d1g69a1, d1g69a2
  • Chain 'B':
    Compound: thiamin phosphate synthase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: THIC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39594 (6-227)
      • cloning artifact (0-5)
      • engineered (122)
    Domains in SCOPe 2.06: d1g69b1, d1g69b2
  • Heterogens: MG, ICP, POP, TZP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g69A (A:)
    hhhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdalt
    gearikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmil
    gvaahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgig
    gitidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g69A (A:)
    hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
    arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
    aahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
    tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g69B (B:)
    hhhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdalt
    gearikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmil
    gvaahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgig
    gitidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr