PDB entry 1g66

View 1g66 on RCSB PDB site
Description: acetylxylan esterase at 0.90 angstrom resolution
Deposited on 2000-11-03, released 2001-01-17
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.107
AEROSPACI score: 1.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g66a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g66A (A:)
    scpaihvfgarettaspgygssstvvngvlsaypgstaeainypacggqsscggasysss
    vaqgiaavasavnsfnsqcpstkivlvgysqggeimdvalcgggdpnqgytntavqlsss
    avnmvkaaifmgdpmfraglsyevgtcaaggfdqrpagfscpsaakiksycdasdpyccn
    gsnaathqgygseygsqalafvksklg