PDB entry 1g64

View 1g64 on RCSB PDB site
Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex
Deposited on 2000-11-03, released 2000-12-20
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g64a_
  • Chain 'B':
    Domains in SCOP 1.59: d1g64b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g64A (A:)
    rgiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqvm
    atgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisal
    narpghqtviitgrgchrdildladtvselrpvkhafdagvkaqmgidy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g64B (B:)
    qqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvgvvqfik
    gtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladplldmvvl
    deltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpvkhafda
    gvkaqmgidy