PDB entry 1g61

View 1g61 on RCSB PDB site
Description: crystal structure of m.jannaschii eif6
Class: translation
Keywords: alpha-beta-barrel velcro closure subdomain, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSLATION
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.132
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor 6
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0048
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g61a_
  • Chain 'B':
    Compound: translation initiation factor 6
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0048
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g61b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g61A (A:)
    mtmiirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvg
    slsvankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgali
    spelkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfk
    veyigkgtankgttsvgaciianskgavvggdttgpelliiedalgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g61A (A:)
    miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl
    svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp
    elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve
    yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g61B (B:)
    mtmiirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvg
    slsvankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgali
    spelkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfk
    veyigkgtankgttsvgaciianskgavvggdttgpelliiedalgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g61B (B:)
    miirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgsl
    svankyglllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalisp
    elkdfkkdiedslnveveigtiaelptvgsnavvtnkgclthplveddeleflkslfkve
    yigkgtankgttsvgaciianskgavvggdttgpelliiedalgl