PDB entry 1g5z

View 1g5z on RCSB PDB site
Description: crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Class: immune system
Keywords: Surface Protein, Alpha helix protein, IMMUNE SYSTEM
Deposited on 2000-11-02, released 2001-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g5za_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5zA (A:)
    pnlteiskkitesnavvlavkevetllasidelatkaigkkignngleanqskntsllsg
    ayaisdliaeklnvlkneelkekidtakqcsteftnklksehavlgldnltddnaqrail
    kkhankdkgaaeleklfkavenlskaaqdtlknavkeltspiva