PDB entry 1g5z

View 1g5z on RCSB PDB site
Description: crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Class: immune system
Keywords: Surface Protein, Alpha helix protein, IMMUNE SYSTEM
Deposited on 2000-11-02, released 2001-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: outer surface protein c
  Species: Borrelia burgdorferi [TaxId:139]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31117 (0-163)
  Domains in SCOPe 2.05: d1g5za_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g5zA (A:)
  pnlteiskkitesnavvlavkevetllasidelatkaigkkignngleanqskntsllsg
  ayaisdliaeklnvlkneelkekidtakqcsteftnklksehavlgldnltddnaqrail
  kkhankdkgaaeleklfkavenlskaaqdtlknavkeltspiva