PDB entry 1g5z

View 1g5z on RCSB PDB site
Description: crystal structure of lyme disease antigen outer surface protein c (ospc) from borrelia burgdorferi strain n40
Deposited on 2000-11-02, released 2001-04-04
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g5za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g5zA (A:)
pnlteiskkitesnavvlavkevetllasidelatkaigkkignngleanqskntsllsg
ayaisdliaeklnvlkneelkekidtakqcsteftnklksehavlgldnltddnaqrail
kkhankdkgaaeleklfkavenlskaaqdtlknavkeltspiva