PDB entry 1g5v

View 1g5v on RCSB PDB site
Description: solution structure of the tudor domain of the human smn protein
Class: translation
Keywords: mRNA processing
Deposited on 2000-11-02, released 2001-05-02
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: survival motor neuron protein 1
    Species: HOMO SAPIENS
    Gene: SMN1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g5va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5vA (A:)
    kkntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdl
    lspicevannieqnaqenenesqvstde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5vA (A:)
    qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspi