PDB entry 1g5v

View 1g5v on RCSB PDB site
Description: solution structure of the tudor domain of the human smn protein
Deposited on 2000-11-02, released 2001-05-02
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1g5va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5vA (A:)
    qqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdllspi